PDB entry 1ad3

View 1ad3 on RCSB PDB site
Description: class 3 aldehyde dehydrogenase complex with nicotinamide-adenine-dinucleotide
Class: oxidoreductase
Keywords: nadp, oxidoreductase, aromatic aldehyde
Deposited on 1996-06-25, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.177
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase (class 3)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ad3a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase (class 3)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ad3b_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ad3A (A:)
    msisdtvkrareafnsgktrslqfriqqlealqrminenlksisgalasdlgknewtsyy
    eevahvleeldttikelpdwaedepvaktrqtqqddlyihseplgvvlvigawnypfnlt
    iqpmvgavaagnavilkpsevsghmadllatlipqymdqnlylvvkggvpettellkerf
    dhimytgstavgkivmaaaakhltpvtlelggkspcyvdkdcdldvacrriawgkfmnsg
    qtcvapdyilcdpsiqnqiveklkkslkdfygedakqsrdygriindrhfqrvkglidnq
    kvahggtwdqssryiaptilvdvdpqspvmqeeifgpvmpivcvrsleeaiqfinqrekp
    lalyvfsnnekvikkmiaetssggvtandvivhitvptlpfggvgnsgmgayhgkksfet
    fshrrsclvksllneeahkaryppspakmprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ad3A (A:)
    sisdtvkrareafnsgktrslqfriqqlealqrminenlksisgalasdlgknewtsyye
    evahvleeldttikelpdwaedepvaktrqtqqddlyihseplgvvlvigawnypfnlti
    qpmvgavaagnavilkpsevsghmadllatlipqymdqnlylvvkggvpettellkerfd
    himytgstavgkivmaaaakhltpvtlelggkspcyvdkdcdldvacrriawgkfmnsgq
    tcvapdyilcdpsiqnqiveklkkslkdfygedakqsrdygriindrhfqrvkglidnqk
    vahggtwdqssryiaptilvdvdpqspvmqeeifgpvmpivcvrsleeaiqfinqrekpl
    alyvfsnnekvikkmiaetssggvtandvivhitvptlpfggvgnsgmgayhgkksfetf
    shrrsclvksllneeahkaryppspa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ad3B (B:)
    msisdtvkrareafnsgktrslqfriqqlealqrminenlksisgalasdlgknewtsyy
    eevahvleeldttikelpdwaedepvaktrqtqqddlyihseplgvvlvigawnypfnlt
    iqpmvgavaagnavilkpsevsghmadllatlipqymdqnlylvvkggvpettellkerf
    dhimytgstavgkivmaaaakhltpvtlelggkspcyvdkdcdldvacrriawgkfmnsg
    qtcvapdyilcdpsiqnqiveklkkslkdfygedakqsrdygriindrhfqrvkglidnq
    kvahggtwdqssryiaptilvdvdpqspvmqeeifgpvmpivcvrsleeaiqfinqrekp
    lalyvfsnnekvikkmiaetssggvtandvivhitvptlpfggvgnsgmgayhgkksfet
    fshrrsclvksllneeahkaryppspakmprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ad3B (B:)
    sisdtvkrareafnsgktrslqfriqqlealqrminenlksisgalasdlgknewtsyye
    evahvleeldttikelpdwaedepvaktrqtqqddlyihseplgvvlvigawnypfnlti
    qpmvgavaagnavilkpsevsghmadllatlipqymdqnlylvvkggvpettellkerfd
    himytgstavgkivmaaaakhltpvtlelggkspcyvdkdcdldvacrriawgkfmnsgq
    tcvapdyilcdpsiqnqiveklkkslkdfygedakqsrdygriindrhfqrvkglidnqk
    vahggtwdqssryiaptilvdvdpqspvmqeeifgpvmpivcvrsleeaiqfinqrekpl
    alyvfsnnekvikkmiaetssggvtandvivhitvptlpfggvgnsgmgayhgkksfetf
    shrrsclvksllneeahkaryppspa