PDB entry 1ad2

View 1ad2 on RCSB PDB site
Description: ribosomal protein l1 mutant with serine 179 replaced by cysteine
Class: ribosomal protein
Keywords: ribosomal protein, RNA binding, protein synthesis, mutant
Deposited on 1997-02-20, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27150 (Start-227)
      • engineered (178)
    Domains in SCOPe 2.07: d1ad2a_
  • Heterogens: SO4, HG, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ad2A (A:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
    gavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkacf
    ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ad2A (A:)
    kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
    phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
    sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkacfppek
    ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs