PDB entry 1ad1

View 1ad1 on RCSB PDB site
Description: dihydropteroate synthetase (apo form) from staphylococcus aureus
Class: transferase
Keywords: synthetase, transferase, dihydropteroate synthetase, dhps, apo form, complex with oh-ch2-pterin-pyrophosphate
Deposited on 1997-02-19, released 1998-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthetase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ad1a_
  • Chain 'B':
    Compound: dihydropteroate synthetase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ad1b_
  • Heterogens: K, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ad1A (A:)
    tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
    eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
    daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
    vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
    nvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ad1A (A:)
    tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
    eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
    daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
    vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
    nvelnaklakgidflkenenarhn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ad1B (B:)
    tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
    eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
    daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
    vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
    nvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ad1B (B:)
    tktkimgilnvtpnvesavtrvkammdegadiidvggvstmitveeelnrvlpvveaivg
    fdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngngnrd
    epvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelvateypv
    llatsrkrftkemmgydttpverdevtaattaygimkgvravrvhnvelnaklakgidfl
    kenenarhnfs