PDB entry 1ad0

View 1ad0 on RCSB PDB site
Description: fab fragment of engineered human monoclonal antibody a5b7
Class: immunoglobulin
Keywords: immunoglobulin, fab fragment
Deposited on 1997-02-19, released 1998-02-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody a5b7 (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAB21182 (4-212)
      • conflict (12)
      • conflict (23)
      • conflict (26-29)
      • conflict (31-32)
      • conflict (40)
      • conflict (44)
      • conflict (48)
      • conflict (50)
      • conflict (53-54)
      • conflict (69)
      • conflict (87-90)
      • conflict (92)
      • conflict (94)
      • conflict (104)
    Domains in SCOPe 2.05: d1ad0a1, d1ad0a2
  • Chain 'B':
    Compound: antibody a5b7 (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1AD0 (0-219)
    Domains in SCOPe 2.05: d1ad0b1, d1ad0b2
  • Chain 'C':
    Compound: antibody a5b7 (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAB21182 (4-212)
      • conflict (12)
      • conflict (23)
      • conflict (26-29)
      • conflict (31-32)
      • conflict (40)
      • conflict (44)
      • conflict (48)
      • conflict (50)
      • conflict (53-54)
      • conflict (69)
      • conflict (87-90)
      • conflict (92)
      • conflict (94)
      • conflict (104)
    Domains in SCOPe 2.05: d1ad0c1, d1ad0c2
  • Chain 'D':
    Compound: antibody a5b7 (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1AD0 (0-219)
    Domains in SCOPe 2.05: d1ad0d1, d1ad0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0A (A:)
    qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr
    fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0B (B:)
    evqllesggglvqpggslrlscatsgftftdyymnwvrqapgkglewlgfignkangytt
    eysasvkgrftisrdkskstlylqmntlqaedsaiyyctrdrglrfyfdywgqgtlvtvs
    sastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0C (C:)
    qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr
    fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0D (D:)
    evqllesggglvqpggslrlscatsgftftdyymnwvrqapgkglewlgfignkangytt
    eysasvkgrftisrdkskstlylqmntlqaedsaiyyctrdrglrfyfdywgqgtlvtvs
    sastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtktytcnvdhkpsntkvdkrve