PDB entry 1ad0

View 1ad0 on RCSB PDB site
Description:
Deposited on 1997-02-19, released 1998-02-25
The last revision prior to the SCOP 1.69 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ad0a1, d1ad0a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ad0b1, d1ad0b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ad0c1, d1ad0c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ad0d1, d1ad0d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0A (A:)
    qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr
    fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0B (B:)
    evqllesggglvqpggslrlscatsgftftdyymnwvrqapgkglewlgfignkangytt
    eysasvkgrftisrdkskstlylqmntlqaedsaiyyctrdrglrfyfdywgqgtlvtvs
    sastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0C (C:)
    qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr
    fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad0D (D:)
    evqllesggglvqpggslrlscatsgftftdyymnwvrqapgkglewlgfignkangytt
    eysasvkgrftisrdkskstlylqmntlqaedsaiyyctrdrglrfyfdywgqgtlvtvs
    sastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtktytcnvdhkpsntkvdkrve