PDB entry 1acz

View 1acz on RCSB PDB site
Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, 5 structures
Deposited on 1997-02-10, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1acz__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1acz_ (-)
  cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
  lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr