PDB entry 1acy

View 1acy on RCSB PDB site
Description: crystal structure of the principal neutralizing site of hiv-1
Class: complex(antibody/hiv-1 fragment)
Keywords: complex(antibody/hiv-1 fragment)
Deposited on 1994-02-10, released 1994-07-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa 59.1 fab (heavy chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1acyh1, d1acyh2
  • Chain 'L':
    Compound: igg1-kappa 59.1 fab (light chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VCI6 (1-214)
      • conflict (3)
      • conflict (11)
      • conflict (25-26)
      • conflict (33)
      • conflict (49)
      • conflict (53)
      • conflict (58)
      • conflict (99)
      • conflict (103)
      • conflict (109-110)
    Domains in SCOP 1.75: d1acyl1, d1acyl2
  • Chain 'P':
    Compound: hiv-1 gp120 (mn isolate)
    Species: Human immunodeficiency virus type 1 (isolate MN)
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acyH (H:)
    qvklqesgpavikpsqslsltcivsgfsitrtnycwhwirqapgkglewmgricyegsiy
    yspsiksrstisrdtslnkffiqlisvtnedtamyycsrenhmyetyfdvwgqgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acyL (L:)
    divmtqspaslvvslgqratiscrasesvdsygksfmhwyqqkpgqppkvliyiasnles
    gvparfsgsgsrtdftltidpveaddaatyycqqnnedpptfgagtklemrradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.