PDB entry 1acy

View 1acy on RCSB PDB site
Description: crystal structure of the principal neutralizing site of hiv-1
Class: complex(antibody/hiv-1 fragment)
Keywords: complex(antibody/hiv-1 fragment)
Deposited on 1994-02-10, released 1994-07-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: igg1-kappa 59.1 fab (heavy chain)
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01869 (121-220)
  Domains in SCOP 1.73: d1acyh1, d1acyh2
• Chain 'L':
  Compound: igg1-kappa 59.1 fab (light chain)
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VCI6 (1-214)
    • conflict (3)
    • conflict (11)
    • conflict (25-26)
    • conflict (33)
    • conflict (49)
    • conflict (53)
    • conflict (58)
    • conflict (99)
    • conflict (103)
    • conflict (109-110)
  Domains in SCOP 1.73: d1acyl1, d1acyl2
• Chain 'P':
  Compound: hiv-1 gp120 (mn isolate)
  Species: Human immunodeficiency virus type 1 (isolate MN)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05877

PDB Chain Sequences:

• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1acyH (H:)
  qvklqesgpavikpsqslsltcivsgfsitrtnycwhwirqapgkglewmgricyegsiy
  yspsiksrstisrdtslnkffiqlisvtnedtamyycsrenhmyetyfdvwgqgttvtvs
  sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
  dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1acyL (L:)
  divmtqspaslvvslgqratiscrasesvdsygksfmhwyqqkpgqppkvliyiasnles
  gvparfsgsgsrtdftltidpveaddaatyycqqnnedpptfgagtklemrradaaptvs
  ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
  stltltkdeyerhnsytceathktstspivksfnr
  

  
  
• Chain 'P':
  No sequence available.