PDB entry 1acy

View 1acy on RCSB PDB site
Description: crystal structure of the principal neutralizing site of hiv-1
Class: complex(antibody/hiv-1 fragment)
Keywords: complex(antibody/hiv-1 fragment)
Deposited on 1994-02-10, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa 59.1 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1acyh1, d1acyh2
  • Chain 'L':
    Compound: igg1-kappa 59.1 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ACY (0-214)
    Domains in SCOPe 2.07: d1acyl1, d1acyl2
  • Chain 'P':
    Compound: hiv-1 gp120 (mn isolate)
    Species: HIV-1 M:B_MN [TaxId:11696]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acyH (H:)
    qvklqesgpavikpsqslsltcivsgfsitrtnycwhwirqapgkglewmgricyegsiy
    yspsiksrstisrdtslnkffiqlisvtnedtamyycsrenhmyetyfdvwgqgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acyL (L:)
    divmtqspaslvvslgqratiscrasesvdsygksfmhwyqqkpgqppkvliyiasnles
    gvparfsgsgsrtdftltidpveaddaatyycqqnnedpptfgagtklemrradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.