PDB entry 1acx

View 1acx on RCSB PDB site
Description: actinoxanthin structure at the atomic level (russian)
Class: antibacterial protein
Keywords: antibacterial protein
Deposited on 1982-12-17, released 1983-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actinoxanthin
    Species: Streptomyces globisporus [TaxId:1908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01551 (0-107)
      • conflict (11)
      • conflict (62)
      • conflict (71)
      • conflict (74)
      • conflict (98)
    Domains in SCOPe 2.08: d1acxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acxA (A:)
    apafsvspasgasdgqsvsvsvaaagetyyiaqcapvggqdacnpatatsfttdasgaas
    fsftvrksyagqtpsgtpvgsvdcatdacnlgagnsglnlghvaltfg