PDB entry 1act

View 1act on RCSB PDB site
Description: structure of actinidin,details of the polypeptide chain conformation and active site from an electron density map at 2.8 angstroms resolution
Deposited on 1977-06-27, released 1977-06-27
The last revision was dated 1977-06-27, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1act_ (-)
lpsyvdwrsagavvdiksqgecggcwafsaiatveginkitsgslislseqelidcgrtq
ntrgcdggyitdgfqfiindggintdenypytaqdgacdvnlqdqkyvtidtyenvpynn
ewalqtavtyqpvsvaldaagdafkqyasgiftgpcgtavdhaivivgygteggvdywiv
knswdttwgeegymrilrnvggagtcgiatmpsypvkyy

  • Chain 'p':
    No sequence available.