PDB entry 1acp

View 1acp on RCSB PDB site
Description: refinement of the nmr structures for acyl carrier protein with scalar coupling data
Class: fatty acid synthesis protein
Keywords: fatty acid synthesis protein
Deposited on 1990-07-29, released 1993-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-carrier protein
    Species: Escherichia coli [TaxId:37762]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1acpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acpA (A:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa