PDB entry 1acm

View 1acm on RCSB PDB site
Description: arginine 54 in the active site of escherichia coli aspartate transcarbamoylase is critical for catalysis: a site-specific mutagenesis, nmr and x-ray crystallography study
Class: transferase (carbamoyl-p,aspartate)
Keywords: transferase (carbamoyl-p, aspartate)
Deposited on 1992-07-08, released 1992-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate carbamoyltransferase, catalytic chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • conflict (53)
      • conflict (59)
      • conflict (146)
      • conflict (148)
      • conflict (195)
    Domains in SCOPe 2.07: d1acma1, d1acma2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (Start-152)
      • conflict (7)
    Domains in SCOPe 2.07: d1acmb1, d1acmb2
  • Chain 'C':
    Compound: aspartate carbamoyltransferase, catalytic chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • conflict (53)
      • conflict (59)
      • conflict (146)
      • conflict (148)
      • conflict (195)
    Domains in SCOPe 2.07: d1acmc1, d1acmc2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (Start-152)
      • conflict (7)
    Domains in SCOPe 2.07: d1acmd1, d1acmd2
  • Heterogens: PAL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acmA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastatrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1acmB (B:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1acmB (B:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acmC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastatrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1acmD (D:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1acmD (D:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan