PDB entry 1aci

View 1aci on RCSB PDB site
Description: l11 ribosomal protein RNA binding domain, nmr, 20 structures
Class: ribosomal protein
Keywords: l11-c76, ribosomal protein
Deposited on 1997-02-07, released 1998-01-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l11 ribosomal protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1acia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aciA (A:)
    mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
    rmiegtarsmgivved