PDB entry 1aci

View 1aci on RCSB PDB site
Description: l11 ribosomal protein rna binding domain, nmr, 20 structures
Deposited on 1997-02-07, released 1998-01-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1aci__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aci_ (-)
  mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
  rmiegtarsmgivved