PDB entry 1aci

View 1aci on RCSB PDB site
Description:
Deposited on 1997-02-07, released 1998-01-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1aci__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aci_ (-)
    mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
    rmiegtarsmgivved