PDB entry 1acf

View 1acf on RCSB PDB site
Description: acanthamoeba castellanii profilin ib
Class: contractile protein
Keywords: protein binding, profilin, actin-binding protein, contractile protein
Deposited on 1994-07-29, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: profilin I
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68696 (0-124)
      • conflict (82)
    Domains in SCOPe 2.08: d1acfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acfA (A:)
    swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgttlagafnnadairaggf
    dlagvhyvtlraddrsiygkkgssgvitvktskailvgvynekiqpgtaanvvekladyl
    igqgf