PDB entry 1acd

View 1acd on RCSB PDB site
Description: v32d/f57h mutant of murine adipocyte lipid binding protein
Class: fatty acid binding protein
Keywords: fatty acid binding protein
Deposited on 1997-02-06, released 1997-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.198
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adipocyte lipid binding protein
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04117 (1-130)
    • engineered (31)
    • engineered (56)
    • modified residue (116)
  Domains in SCOPe 2.08: d1acda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1acdA (A:)
  gdafvgtwklvssenfddymkevgvgfatrkdagmakpnmiisvngdlvtirsesthknt
  eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
  gvtstrvyera