PDB entry 1acc

View 1acc on RCSB PDB site
Description: anthrax protective antigen
Class: toxin
Keywords: toxin, calcium-binding
Deposited on 1997-02-05, released 1998-02-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anthrax protective antigen
    Species: Bacillus anthracis [TaxId:1392]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1acca_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1accA (A:)
    evkqenrllnesesssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyf
    qsaiwsgfikvkksdeytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqy
    qrenptekgldfklywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdn
    dgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpysdfekvt
    gridknvspearhplvaaypivhvdmeniilsknedqstqntdsetrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsev
    lpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnl
    qyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydr
    nniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindry
    dmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstng
    ikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1accA (A:)
    sssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkk
    sdeytfatsadnhvtmwvddqevinsnkirlekgrlyqikiqyqrenptekgldfklywt
    dsqnkkevissdnlqlpelkqkssvpdrdndgipdslevegytvdvknkrtflspwisni
    hekkgltkyksspekwstasdpysdfekvtgridknvspearhplvaaypivhvdmenii
    lsknetiskntstsrthtsevvsagfsnsnsstvaidhslslagglntadtarlnaniry
    vntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqdd
    fsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqe
    ttariifngkdlnlverriaavnpsttkpdmtlkealkiafgfnepngnlqyqgkditef
    dfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgades
    vvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrq
    dgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskk
    gyeig