PDB entry 1acb

View 1acb on RCSB PDB site
Description: crystal and molecular structure of the bovine alpha-chymotrypsin-eglin c complex at 2.0 angstroms resolution
Deposited on 1991-11-08, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.55: d1acbe_
  • Chain 'I':
    Domains in SCOP 1.55: d1acbi_

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1acbE (E:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1acbE (E:)
    cgvpaiqpvlsglivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtt
    sdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavc
    lpsasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicag
    asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
    n
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1acbI (I:)
    ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
    hvg