PDB entry 1aca

View 1aca on RCSB PDB site
Description: three-dimensional structure of the complex between acyl-coenzyme a binding protein and palmitoyl-coenzyme a
Class: acyl-coenzyme a binding protein
Keywords: acyl-coenzyme a binding protein
Deposited on 1992-11-17, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acyl-coenzyme a binding protein
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07107 (0-85)
  Domains in SCOPe 2.05: d1acaa_
• Heterogens: COA, PLM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1acaA (A:)
  sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne
  lkgtskedamkayidkveelkkkygi