PDB entry 1ac6
View 1ac6 on RCSB PDB site
Description: crystal structure of a variable domain mutant of a T-cell receptor alpha chain
Class: receptor
Keywords: receptor, v alpha domain, site-directed mutagenesis, three-dimensional structure, glycoprotein
Deposited on
1997-02-13, released
1998-02-25
The last revision prior to the SCOPe 2.05 freeze date was dated
2013-03-20, with a file datestamp of
2013-03-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.161
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: T-cell receptor alpha
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Uniprot P06323 (0-109)
- conflict (65)
- conflict (67-68)
- conflict (74)
- insertion (92)
- engineered mutation (94-96)
- engineered mutation (98)
- conflict (101)
- conflict (104)
- conflict (107-108)
Domains in SCOPe 2.05: d1ac6a_ - Chain 'B':
Compound: T-cell receptor alpha
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Uniprot P06323 (0-109)
- conflict (65)
- conflict (67-68)
- conflict (74)
- insertion (92)
- engineered mutation (94-96)
- engineered mutation (98)
- conflict (101)
- conflict (104)
- conflict (107-108)
Domains in SCOPe 2.05: d1ac6b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ac6A (A:)
dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ac6B (B:)
dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp