PDB entry 1ac6

View 1ac6 on RCSB PDB site
Description: crystal structure of a variable domain mutant of a T-cell receptor alpha chain
Class: receptor
Keywords: receptor, v alpha domain, site-directed mutagenesis, three-dimensional structure, glycoprotein
Deposited on 1997-02-13, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.161
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: T-cell receptor alpha
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06323 (0-109)
    • conflict (65)
    • conflict (67-68)
    • conflict (74)
    • insertion (92)
    • engineered mutation (94-96)
    • engineered mutation (98)
    • conflict (101)
    • conflict (104)
    • conflict (107-108)
  Domains in SCOPe 2.08: d1ac6a_
• Chain 'B':
  Compound: T-cell receptor alpha
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06323 (0-109)
    • conflict (65)
    • conflict (67-68)
    • conflict (74)
    • insertion (92)
    • engineered mutation (94-96)
    • engineered mutation (98)
    • conflict (101)
    • conflict (104)
    • conflict (107-108)
  Domains in SCOPe 2.08: d1ac6b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ac6A (A:)
  dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
  featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ac6B (B:)
  dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
  featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp