PDB entry 1ac5

View 1ac5 on RCSB PDB site
Description: crystal structure of kex1(delta)p, a prohormone-processing carboxypeptidase from saccharomyces cerevisiae
Deposited on 1997-02-13, released 1997-05-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ac5__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ac5_ (-)
    lpsseeykvayellpglsevpdpsnipqmhaghiplrsedadeqdssdleyffwkftnnd
    sngnvdrpliiwlnggpgcssmdgalvesgpfrvnsdgklylnegswiskgdllfidqpt
    gtgfsveqnkdegkidknkfdedledvtkhfmdflenyfkifpedltrkiilsgesyagq
    yipffanailnhnkfskidgdtydlkalligngwidpntqslsylpfamekklidesnpn
    fkhltnahencqnlinsastdeaahfsyqecenilnlllsytressqkgtadclnmynfn
    lkdsypscgmnwpkdisfvskffstpgvidslhldsdkidhwkectnsvgtklsnpiskp
    sihllpgllesgieivlfngdkdlicnnkgvldtidnlkwggikgfsddavsfdwihksk
    stddseefsgyvkydrnltfvsvynashmvpfdkslvsrgivdiysndvmiidnngknvm
    itt