PDB entry 1ac1

View 1ac1 on RCSB PDB site
Description: dsba mutant h32l
Class: disulfide oxidoreductase
Keywords: disulfide oxidoreductase, thioredoxin fold, redox-active center
Deposited on 1997-02-10, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dsba
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ac1a_
  • Chain 'B':
    Compound: dsba
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ac1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ac1A (A:)
    aqyedgkqyttlekpvagapqvleffsffcplcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ac1A (A:)
    aqyedgkqyttlekpvagapqvleffsffcplcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ac1B (B:)
    aqyedgkqyttlekpvagapqvleffsffcplcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ac1B (B:)
    aqyedgkqyttlekpvagapqvleffsffcplcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek