PDB entry 1abz

View 1abz on RCSB PDB site
Description: alpha-t-alpha, a de novo designed peptide, nmr, 23 structures
Class: de novo design
Keywords: de novo design, helix-turn-helix, peptide
Deposited on 1997-01-31, released 1998-02-04
The last revision prior to the SCOP 1.73 freeze date was dated 1998-02-04, with a file datestamp of 2007-06-04.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-t-alpha
    Domains in SCOP 1.73: d1abza_
  • Heterogens: NH2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abzA (A:)
    xdwlkarveqelqaleargtdsnaelrameaklkaeiqk