PDB entry 1abz

View 1abz on RCSB PDB site
Description: alpha-t-alpha, a de novo designed peptide, nmr, 23 structures
Class: de novo design
Keywords: de novo design, helix-turn-helix, peptide
Deposited on 1997-01-31, released 1998-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-t-alpha
  Database cross-references and differences (RAF-indexed):
  • PDB 1ABZ (0-End)
  Domains in SCOPe 2.08: d1abza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1abzA (A:)
  xdwlkarveqelqaleargtdsnaelrameaklkaeiqk