PDB entry 1aby

View 1aby on RCSB PDB site
Description: cyanomet rhb1.1 (recombinant hemoglobin)
Deposited on 1997-01-29, released 1998-02-25
The last revision prior to the SCOP 1.71 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.175
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abyA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrgvlspadktnvkaawgkvgahageygaealermflsfpt
    tktyfphfdlshgsaqvkghgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnf
    kllshcllvtlaahlpaeftpavhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abyB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abyD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh