PDB entry 1abx

View 1abx on RCSB PDB site
Description: alpha-*bungarotoxin structure revealed by a rapid method for averaging electron density of non-crystallographically translationally related molecules
Deposited on 1980-04-01, released 1980-06-05
The last revision was dated 1986-05-07, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1abx_ (-)
ivchttatipssavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnhppkrqpg

  • Chain 'p':
    No sequence available.