PDB entry 1abw

View 1abw on RCSB PDB site
Description: deoxy rhb1.1 (recombinant hemoglobin)
Deposited on 1997-01-29, released 1998-06-17
The last revision prior to the SCOP 1.55 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abwA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrgvlspadktnvkaawgkvgahageygaealermflsfpt
    tktyfphfdlshgsaqvkghgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnf
    kllshcllvtlaahlpaeftpavhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abwB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abwD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh