PDB entry 1abv

View 1abv on RCSB PDB site
Description: n-terminal domain of the delta subunit of the f1f0-atp synthase from escherichia coli, nmr, minimized average structure
Deposited on 1997-01-29, released 1997-07-07
The last revision prior to the SCOP 1.71 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1abv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1abv_ (-)
    sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
    iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseataevdvisaaalseqq
    lakisaamekrlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1abv_ (-)
    sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
    iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat