PDB entry 1abt

View 1abt on RCSB PDB site
Description: nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Class: toxin
Keywords: toxin
Deposited on 1993-11-17, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-bungarotoxin
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1abta_
  • Chain 'B':
    Compound: nicotinic receptor peptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abtA (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    No sequence available.