PDB entry 1abt

View 1abt on RCSB PDB site
Description: nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Deposited on 1993-11-17, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1abta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abtA (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg