PDB entry 1abt

View 1abt on RCSB PDB site
Description: nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Class: toxin
Keywords: toxin
Deposited on 1993-11-17, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-bungarotoxin
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60615 (0-73)
  Domains in SCOPe 2.08: d1abta_
• Chain 'B':
  Compound: nicotinic receptor peptide
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02710 (0-End)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1abtA (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg
  

  
  
• Chain 'B':
  No sequence available.