PDB entry 1abs

View 1abs on RCSB PDB site
Description: photolysed carbonmonoxy-myoglobin at 20 k
Class: oxygen storage
Keywords: oxygen storage, intermediate in ligand binding, respiratory protein
Deposited on 1997-01-28, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.207
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon, synthetic [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
  Domains in SCOPe 2.08: d1absa_
• Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1absA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg