PDB entry 1abr

View 1abr on RCSB PDB site
Description: crystal structure of abrin-a
Class: glycosidase/carbohydrate
Keywords: GLYCOSIDASE/CARBOHYDRATE complex, LECTIN, LECTIN (AGGLUTININ), GLYCOPROTEIN, PLANT SEED PROTEIN, PLANT TOXIN, PROTEIN SYNTHESIS INHIBITOR, TOXIN
Deposited on 1994-11-11, released 1995-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: abrin-a
    Species: Abrus precatorius [TaxId:3816]
    Database cross-references and differences (RAF-indexed):
    • GB AAA32624 (0-250)
    Domains in SCOPe 2.06: d1abra_
  • Chain 'B':
    Compound: abrin-a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1abrb1, d1abrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abrA (A:)
    edrpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlqernryitvelsnsd
    tesievgidvtnayvvayragtqsyflrdapssasdylftgtdqhslpfygtygdlerwa
    hqsrqqiplglqalthgisffrsggndneekartliviiqmvaeaarfryisnrvrvsiq
    tgtafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnepvivdslshptvavl
    almlfvcnppn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abrB (B:)
    ivekskicssryeptvriggrdgmcvdvydngyhngnriimwkckdrleenqlwtlksdk
    tirsngkclttygyapgsyvmiydctsavaeatyweiwdngtiinpksalvlsaesssmg
    gtltvqtneylmrqgwrtgnntspfvtsisgysdlcmqaqgsnvwmadcdsnkkeqqwal
    ytdgsirsvqntnncltskdhkqgstillmgcsngwasqrwvfkndgsiyslyddmvmdv
    kgsdpslkqiilwpytgkpnqiwltlf