PDB entry 1abr

View 1abr on RCSB PDB site
Description: crystal structure of abrin-a
Deposited on 1994-11-11, released 1995-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2.14 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abrA (A:)
    edrpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlqernryitvelsnsd
    tesievgidvtnayvvayragtqsyflrdapssasdylftgtdqhslpfygtygdlerwa
    hqsrqqiplglqalthgisffrsggndneekartliviiqmvaeaarfryisnrvrvsiq
    tgtafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnepvivdslshptvavl
    almlfvcnppn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abrB (B:)
    ivekskicssryeptvriggrdgmcvdvydngyhngnriimwkckdrleenqlwtlksdk
    tirsngkclttygyapgsyvmiydctsavaeatyweiwdngtiinpksalvlsaesssmg
    gtltvqtneylmrqgwrtgnntspfvtsisgysdlcmqaqgsnvwmadcdsnkkeqqwal
    ytdgsirsvqntnncltskdhkqgstillmgcsngwasqrwvfkndgsiyslyddmvmdv
    kgsdpslkqiilwpytgkpnqiwltlf