PDB entry 1abq

View 1abq on RCSB PDB site
Description: crystal structure of the unliganded abl tyrosine kinase sh3 domain
Deposited on 1995-05-19, released 1995-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1abq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abq_ (-)
    lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn