PDB entry 1abq

View 1abq on RCSB PDB site
Description: crystal structure of the unliganded abl tyrosine kinase sh3 domain
Class: kinase
Keywords: sh3 domain, transferase (phosphotransferase), proto-oncogene, kinase
Deposited on 1995-05-19, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: abl tyrosine kinase src-homology 3 (sh3) domain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00520
  Domains in SCOPe 2.08: d1abqa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1abqA (A:)
  mndpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv
  ns
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1abqA (A:)
  lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn