PDB entry 1abm

View 1abm on RCSB PDB site
Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
Deposited on 1992-08-27, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abmA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abmB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk