PDB entry 1abm

View 1abm on RCSB PDB site
Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-08-27, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 1993-10-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1abma3, d1abma4
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1abmb3, d1abmb4
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abmA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1abmB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk