PDB entry 1abk

View 1abk on RCSB PDB site
Description: atomic structure of the /dna$ repair [4*fe-4*s] enzyme endonuclease /iii$
Deposited on 1992-09-15, released 1993-07-15
The last revision was dated 1995-01-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FS4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1abk_ (-)
mnkakrleiltrlrennphpttelnfsspfelliavllsaqatdvsvnkataklypvant
paamlelgvegvktyiktiglynskaeniiktcrilleqhngevpedraalealpgvgrk
tanvvlntafgwptiavdthifrvcnrtqfapgknveqveekllkvvpaefkvdchhwli
lhgrytciarkprcgsciiedlceykekvdi

  • Chain 'p':
    No sequence available.