PDB entry 1abe

View 1abe on RCSB PDB site
Description: novel stereospecificity of the l-arabinose-binding protein
Class: binding protein
Keywords: binding protein
Deposited on 1992-04-23, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-arabinose-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1abea_
  • Heterogens: ARA, ARB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1abeA (A:)
    enlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakg
    fvictpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqe
    lykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndip
    gafdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsel
    skaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelek
    kglggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1abeA (A:)
    nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
    victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
    ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
    afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
    kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
    glggk