PDB entry 1aba

View 1aba on RCSB PDB site
Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin). refinement of native and mutant proteins
Deposited on 1992-04-24, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.45 Å
R-factor: 0.175
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1aba__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aba_ (-)
  mfkvygydsnihkcgpcdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
  igltmpqvfapdgshiggfdqlreyfk