PDB entry 1ab6

View 1ab6 on RCSB PDB site
Description: structure of chey mutant f14n, v86t
Class: chemotaxis
Keywords: chemotaxis, sensory transduction, phosphorylation, flagellar rot
Deposited on 1997-02-04, released 1998-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-124)
    • engineered (9)
    • engineered (81)
  Domains in SCOPe 2.08: d1ab6a_
• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-124)
    • engineered (9)
    • engineered (81)
  Domains in SCOPe 2.08: d1ab6b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ab6A (A:)
  elkflvvddnstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
  glellktiradgamsalpvlmttaeakkeniiaaaqagasgyvvkpftaatleeklnkif
  eklgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ab6B (B:)
  elkflvvddnstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
  glellktiradgamsalpvlmttaeakkeniiaaaqagasgyvvkpftaatleeklnkif
  eklgm