PDB entry 1ab5

View 1ab5 on RCSB PDB site
Description: structure of chey mutant f14n, v21t
Class: chemotaxis
Keywords: chemotaxis, sensory transduction, phosphorylation, flagellar rot
Deposited on 1997-02-04, released 1998-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chey
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-124)
      • engineered (9)
      • engineered (16)
    Domains in SCOPe 2.08: d1ab5a_
  • Chain 'B':
    Compound: chey
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-124)
      • engineered (9)
      • engineered (16)
    Domains in SCOPe 2.08: d1ab5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ab5A (A:)
elkflvvddnstmrritrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
glellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnkif
eklgm

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ab5B (B:)
elkflvvddnstmrritrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmd
glellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnkif
eklgm