PDB entry 1ab4

View 1ab4 on RCSB PDB site
Description: 59kda fragment of gyrase a from e. coli
Class: topoisomerase
Keywords: topoisomerase II, gyrase, supercoiling DNA, topoisomerase
Deposited on 1997-02-03, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gyrase a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ab4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ab4A (A:)
    vgralpdvrdglkpvhrrvlyamnvlgndwnkaykksarvvgdvigkyhphgdsavydti
    vrmaqpfslrymlvdgqgnfgsidgdsaaamryteirlakiahelmadleketvdfvdny
    dgtekipdvmptkipnllvngssgiavgmatnipphnltevingclayiddedisieglm
    ehipgpdfptaaiingrrgieeayrtgrgkvyiraraevevdaktgretiivheipyqvn
    karliekiaelvkekrvegisalrdesdkdgmrivievkrdavgevvlnnlysqtqlqvs
    fginmvalhhgqpkimnlkdiiaafvrhrrevvtrrtifelrkardrahilealavalan
    idpiielirhaptpaeaktalvanpwqlgnvaamleragddaarpewlepefgvrdglyy
    lteqqaqaildlrlqkltgleheklldeykelldqiaellrilgsadrlmevireelelv
    reqfgdkrrteit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ab4A (A:)
    vgralpdvrdglkpvhrrvlyamnvlgndwnkaykksarvvgdvigkyhphgdsavydti
    vrmaqpfslrymlvdgqgnfgsidgdsaaamryteirlakiahelmadleketvdfvdny
    dgtekipdvmptkipnllvngssgiavgmatnipphnltevingclayiddedisieglm
    ehipgpdfptaaiingrrgieeayrtgrgkvyiraraevevetiivheipyqvnkarlie
    kiaelvkekrvegisalrdesdkdgmriviegevvlnnlysqtqlqvsfginmvalhhgq
    pkimnlkdiiaafvrhrrevvtrrtifelrkardrahilealavalanidpiielirhap
    tpaeaktalvanpwqlgnvaamledaarpewlepefgvrdglyylteqqaqaildlrlqk
    ltgleheklldeykelldqiaellrilgsadrlmevireelelvreqfgdkrrteit