PDB entry 1ab2

View 1ab2 on RCSB PDB site
Description: three-dimensional solution structure of the src homology 2 domain of c-abl
Class: transferase(phosphotransferase)
Keywords: transferase(phosphotransferase)
Deposited on 1993-07-19, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: c-abl tyrosine kinase sh2 domain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00519 (3-103)
  Domains in SCOPe 2.08: d1ab2a1, d1ab2a2, d1ab2a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ab2A (A:)
  gsgnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyri
  ntasdgklyvssesrfntlaelvhhhstvadglittlhypapkrgihrd