PDB entry 1aaz

View 1aaz on RCSB PDB site
Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)
Class: electron transport
Keywords: electron transport
Deposited on 1992-04-24, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glutaredoxin
  Species: Enterobacteria phage T4 [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00276 (0-86)
  Domains in SCOPe 2.07: d1aaza_
• Chain 'B':
  Compound: glutaredoxin
  Species: Enterobacteria phage T4 [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00276 (0-86)
  Domains in SCOPe 2.07: d1aazb_
• Heterogens: CD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aazA (A:)
  mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
  igltmpqvfapdgshiggfdqlreyfk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aazB (B:)
  mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
  igltmpqvfapdgshiggfdqlreyfk