PDB entry 1aaz

View 1aaz on RCSB PDB site
Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)
Deposited on 1992-04-24, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1aaza_
  • Chain 'B':
    Domains in SCOP 1.55: d1aazb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aazA (A:)
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aazB (B:)
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk