PDB entry 1aaz
View 1aaz on RCSB PDB site
Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)
Class: electron transport
Keywords: electron transport
Deposited on
1992-04-24, released
1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: glutaredoxin
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aaza_ - Chain 'B':
Compound: glutaredoxin
Species: Enterobacteria phage T4 [TaxId:10665]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aazb_ - Heterogens: CD, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1aazA (A:)
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1aazB (B:)
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk